PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0001s1700.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 527aa    MW: 58706.3 Da    PI: 7.4747
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0001s1700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS225.52.5e-692915171229
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                             l++lL++cA+av+++d + a++lL++++ ++sp gd ++Rla++f+ +L+arla+++s++yk l +++ts    ++ l+a++l+  +
  SapurV1A.0001s1700.2.p 291 LRTLLISCAQAVAADDRRSANELLKQIRLHSSPFGDGNRRLAHCFADGLEARLAGTGSQIYKGLVSKRTS---AADLLKAYRLYLAA 374
                             6789************************************************************999999...9************* PP

                    GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeel 172
                             +P+ k+ +++ N++I  a+ ++ r+H+iDf+i +G+QWp++++ L++Rp+gpp+lR+Tg++ p++g   +e++eetg+rLa +A+e+
  SapurV1A.0001s1700.2.p 375 CPFRKVFNFVSNKTIRYAAGNSMRLHVIDFGILYGFQWPTFIHRLSCRPGGPPKLRMTGIEFPQPGfrPAERVEETGRRLAAYAKEF 461
                             *****************************************************************9********************* PP

                    GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLk 229
                             +vpfe+n+ +ak++e+++leeL+++p+E+++Vn+ ++ ++llde+v+++s+r+ vL+
  SapurV1A.0001s1700.2.p 462 KVPFEYNA-IAKKWETIQLEELKLDPDEVVVVNCLYRAKNLLDETVAVDSPRNIVLD 517
                             ********.7****************************************9998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.96265526IPR005202Transcription factor GRAS
PfamPF035148.6E-67291517IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MRYINQMLME EDTEAKTCVL QDSLDLQAAE KSFYDVLGKK YPPSPEPYPT FISQNRRNLP  60
DCLPCNYICS SSSDSGYVDD NAWIHNPSDY HSFQLQTPHV SSISQSSYSS SNSVITTVDG  120
LVDSPNSNFK VPDWSGESQS ILHFRKGVEE ASRFLPSSND LFLNIEANKF LSQEPKVKTS  180
EVDIKVEKQD EGEHSPSGSR GKKNLHREDG DVEEGRSSKQ LAVYTESILR SDMFDKVLLC  240
MPGEGQPDLT ALREAFKSAS IKNEQNGHAK GSSGVKGRGK KQSGKKEVVD LRTLLISCAQ  300
AVAADDRRSA NELLKQIRLH SSPFGDGNRR LAHCFADGLE ARLAGTGSQI YKGLVSKRTS  360
AADLLKAYRL YLAACPFRKV FNFVSNKTIR YAAGNSMRLH VIDFGILYGF QWPTFIHRLS  420
CRPGGPPKLR MTGIEFPQPG FRPAERVEET GRRLAAYAKE FKVPFEYNAI AKKWETIQLE  480
ELKLDPDEVV VVNCLYRAKN LLDETVAVDS PRNIVLDLGG SECYSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-292955058218GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011019853.10.0PREDICTED: scarecrow-like protein 9 isoform X2
SwissprotO809331e-167SCL9_ARATH; Scarecrow-like protein 9
TrEMBLB9HBM90.0B9HBM9_POPTR; Uncharacterized protein
STRINGPOPTR_0006s08690.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-162GRAS family protein